Homologous proteins - amino acid sequence in fasta format, Biology

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 

Posted Date: 3/7/2013 5:26:39 AM | Location : United States







Related Discussions:- Homologous proteins - amino acid sequence in fasta format, Assignment Help, Ask Question on Homologous proteins - amino acid sequence in fasta format, Get Answer, Expert's Help, Homologous proteins - amino acid sequence in fasta format Discussions

Write discussion on Homologous proteins - amino acid sequence in fasta format
Your posts are moderated
Related Questions
What are the cells that form the cartilaginous tissue? The main cells of the cartilages are the chondrocytes, originate from the chondroblasts that secrete the intersticial ma


Undescended Testes (Cryptorchidism) Undescended testes is a ccmmon disorder. It may be unilateral and may be classified as ectopic cryptorchidism, when the testes are normal

Types of Respiratory Organs Respiratory organs may be of the following types: Those that have respiratory surface turned out forming an evagination. These are called gi

On a separate piece of paper, draw a simple family tree for a couple showing children (F1), and lineages from two children showing grand children (G2), great grandchildren (G3), gr

Explain the Prevalence of Iodine Deficiency Disorders? We can determine the prevalence of IDD by conducting population surveys. Most of the population surveys are based on clin

What are the main cytoplasmic structures present in animal cells? Ans) The major cytoplasmic structures of the cell are the centrioles, the cytoskeleton, lysosomes, mitochondria

Fatty  acids  are  synthesized  in  the  cytosol,  but  acetyl  CoA  is  produce  from pyruvate in the mitochondria. Therefore the acetyl CoA must be transferred  from  the mitocho

Cell culture products: Animal cell cultures are used to generate virus vaccines, as well as different kind  of useful biochemical which are mainly high molecular weight prote

What is sustainability? Sustainability is the ability to meet human needsin a way that will allow a human population to survive indefinitely.