Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Explain database search, Database Search: Once an open reading frame or th...

Database Search: Once an open reading frame or the partial amino acid sequence has been pre-determined, the investigator compares sequence with others in the databases using a com

Describe about the halstead''s discriminating tests, Describe about the Hal...

Describe about the Halstead's discriminating tests Halstead's discriminating tests are viewed as a measure of adaptive abilities, of skills that ensured man's survival on the p

Define solvent chemical potentials from phase equilibria, Define Solvent Ch...

Define Solvent Chemical Potentials from Phase Equilibria? Previously explained how we can evaluate the activity coefficient γ m,B of a nonelectrolyte solute of a binary soluti

What is hipot test ?, Hipot is an abbreviation for high potential. Usually,...

Hipot is an abbreviation for high potential. Usually, Hipot is a term given to a class of electrical safety testing instruments used to confirm electrical insulation in finished ap

Explain the objectives of congenital heart disease, Explain the Objectives ...

Explain the Objectives of Congenital Heart Disease ? After reading this unit, you should be able to: 1 Comprehenced the epidemiologic significance of congenital heart disease (

Explain what an isotonic fluid loss means, Your client has the flu and repo...

Your client has the flu and reports 5-6 loose stools a day. He has experienced an isotonic fluid volume loss. Explain what an isotonic fluid loss means.

Enzyme activity, Enzyme Activity Enzymes are biomolecules which catalyz...

Enzyme Activity Enzymes are biomolecules which catalyze (i.e. increase the rates of) chemical reactions. Almost all enzymes are proteins. In enzymatic reactions, the molecules

List the parameters in which we evaluate implant prosthesis, List the param...

List the parameters under which you will evaluate implant prosthesis The various parameters under which implant prosthesis can be evaluated are: i) Assessment of mobility.

Hyaluronic acid, H Y ALURONI C ACID It is formed by alternating u...

H Y ALURONI C ACID It is formed by alternating unit of D-glucuronic acid and N-acetylglucosamine. Hyaluronic acid acts as animal cement between adjacent animal cells

How are triglycerides made, How are triglycerides made? Triglycerides, ...

How are triglycerides made? Triglycerides, fats or oils, are made of three molecules of fatty acids bound to single molecule of glycerol. Hydroxyls of each one of the three fat

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd