Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Describe coping strategies, Patient and his family have to cope up with a ...

Patient and his family have to cope up with a critical situation when patient has complications and more so when a patient has to be admitted in a hospital and referred. Some patie

Define cell plate, Cell plate:  In the plants, a membrane-bound space produ...

Cell plate:  In the plants, a membrane-bound space produced during the process of cytokinesis by the vesicles of the Golgi apparatus. The cell plate fuses with plasma membrane, sep

Side efleects of antipsychotic drugs, Side Efleects of Antipsychotic Drugs:...

Side Efleects of Antipsychotic Drugs: The most common side effects are symptoms of central nervous system i.e. Extrapyramidal  Symptoms (EPS)  including such as:  Parkinso

Photosynthesis and nutrition in plants, In a school laboratory, what is usu...

In a school laboratory, what is usually regarded as evidence that photosynthetis has occurred in a plant

What are biological troubles, What are the biological troubles that mollusc...

What are the biological troubles that molluscs face due to their soft body? Because molluscs have a soft body they are more fragile. They also have more complexity to support t

Define drug effects on vitamin and mineral metabolism, Define Drug effects ...

Define Drug effects on Vitamin and mineral metabolism? Vitamin and mineral metabolism: Micronutrients are required as cofactors or coenzymes in many metabolic pathways, includi

.phylum pisces, wt is an air bladder and its function wt is catadromous and...

wt is an air bladder and its function wt is catadromous and anadromus migration

Pulmonary edema, Pulmonary edema occurs when movement of liquid from the bl...

Pulmonary edema occurs when movement of liquid from the blood to the interstitial space and/or into the alveoli exceeds the return of liquid to the blood and its drainage through t

Pre-procedural mouth rinse, Pre-procedural mouth rinse Patients' use of...

Pre-procedural mouth rinse Patients' use of a an anti-microbial mouthwash of 0.12% chlorhexidine gluconate solution for 30 seconds prior to intra-oral procedures will reduce th

Determine some dietary sources of vitamin c, Determine some Dietary Sources...

Determine some Dietary Sources of Vitamin C? Fruits (particularly citrus fruits), vegetables are the best sources of ascorbic acid. Amla is the richest source of ascorbic acid.

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd