Homologous proteins - amino acid sequence in fasta format, Biology

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 

Posted Date: 3/7/2013 5:26:39 AM | Location : United States







Related Discussions:- Homologous proteins - amino acid sequence in fasta format, Assignment Help, Ask Question on Homologous proteins - amino acid sequence in fasta format, Get Answer, Expert's Help, Homologous proteins - amino acid sequence in fasta format Discussions

Write discussion on Homologous proteins - amino acid sequence in fasta format
Your posts are moderated
Related Questions
What was the case of Phineas Gage Some Procedures are not used experimentally on humans, but sometimes brain tissue is ablated for medical reasons such as the excision of tumo

Q. How is the respiratory system of beings of the phylum Annelida characterized? Respiration in annelids can be branchial or cutaneous. Cutaneous respiration takes place due to

Q According to the cellular organization how are living beings divided into two groups? Cellular beings are divided into two groups, unicellular beings and the prokaryotes whos

Of which substance are microfilaments made? What are the properties of these elements that give motility to cells? Microfilaments are made of actin (a protein). The contractile

Q. Illustrate Bite-wing radiographs? The short and long-term evaluation of crestal bone loss around implants is best evaluated with intraoral radiographs. Threaded implants mak

For a sample containing both protein and nucleic acid, the absorbance measured at a particular wavelength will be the sum of contributions from both types of molecule. Using the pr

ADP-ATP system  of energy  exchange : In 1929 Lohmann, Fiske and  subbarow  published  their  discovery  that the energy  exchanges  compounds in all biological  systems  are t

Members belonging to the scientific community fear the misuse of this therapy leading to dangerous consequences.  People may try to insert the desired gene, for example, the gene f

#question.bacteria and virus are meet so what happen.

Advise on Rest, recreation, sleep The patient should take enough rest and get good sleep. Restrict the visitors so that the patient can get enough rest. Not to strain th