Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Explain radiation sterilization, Explain radiation sterilization Variou...

Explain radiation sterilization Various studies have been conducted which show the effect of processing on vitamins especially, thiamine. In one study, which compared the effec

What is enhancers , While  various  positive  control  components  li...

While  various  positive  control  components  lie  close  to the  gene  they  regulate additional can be situated long distances away (sometimes 10-50 kb) either upstream or downs

Probability concept of requirements vs risk of deficient, Define Probabilit...

Define Probability concept of requirements vs risk of deficient and excess intake? Figure best illustrates the concept of a requirement for an essential nutrient. The relations

How many progeny flies are expected, How many progeny flies are expected to...

How many progeny flies are expected to have full wings and gray bodies?

Bio geographical evidence of evolution, BIO GEOGRAPHICAL EVIDENCE- T...

BIO GEOGRAPHICAL EVIDENCE- The patterns of distribution of animals and plants in different parts of the globe are termed as biogeography. It is believed that around carbo

Types of neurons, TYPE S OF NEURONS - The neurons are classified on th...

TYPE S OF NEURONS - The neurons are classified on the basis of their structure and function. (A) On the basis of the structure, the neurons are of four types.

Explain process to maintain the quality of frying oil, Maintaining the qual...

Maintaining the quality of frying oil  As frying continues, the level of oil in the fryer depletes. There are two beneficial frying fat quality factors affected during the fryi

Defina about the lipid metabolism, Defina about the Lipid Metabolism? A...

Defina about the Lipid Metabolism? Animal studies consistently show a hypotriglyceridenlic effect although equivocal results have been seen with healthy humans. Hypotriglycerid

Formation of gametes, In his experiments, Mendel noted that when two traits...

In his experiments, Mendel noted that when two traits are involved in a genetic cross, they are inherited independently of each other. The reason for this is that A. genes on the s

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd