Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Pathogenesis of acute rheumatic fever, You have learnt about the epidemiolo...

You have learnt about the epidemiology, etiology and pathogenesis of acute rheumatic fever. Revised Jones criteria, which have major and minor criteria, are helping to diagnosis of

Polyphyletic theory, Please I need short notes on polyphylrtic theory

Please I need short notes on polyphylrtic theory

Segmentation in regenerating annelids, Segmentation in Regenerating Annelid...

Segmentation in Regenerating Annelids Several worms as they grow continue to add new segments at the posterior end. In these, segmentation takes place in a growth zone located

Explain about the cheese making - methods of food processing, Explain about...

Explain about the Cheese Making - methods of food processing? Cheese is a way of preserving milk for long periods of time. In this process, the milk in cheese becomes something

Adrenal glands, Adrenal glands There are two adrenal glands one each...

Adrenal glands There are two adrenal glands one each on the top of each kidney. Adrenal gland has two parts, the outer cortex and inner medulla. Both cortex and medull

Possible factors contributing to environmental disasters, 1.      The Combi...

1.      The Combination Of Rapid Industrial Growth, Lack Of Regulations, Inadequate Supervision Of Safety Measures By The Authorities And Lack Of Sufficient Opportunities For The L

Brain region that triggers the voluntary motor activity, Which is the brain...

Which is the brain region that receives conscious sensory information? Which is the brain region that triggers the voluntary motor activity? In the brain conscious sensory info

What resources are competed for by animals, What resources are competed for...

What resources are competed for by (a) animals, (b) plants?  (a) Animals compete for food, mates and shelter.  (b) Plants compete for light, water and minerals.

Explain founder effect, Founder effect The difference in gene pools amongs...

Founder effect The difference in gene pools amongs an original population and a new population founded by one or a few individuals randomly separated from the original population,

Why urea is known to denature proteins, Urea is known to denature proteins ...

Urea is known to denature proteins Based on the structure of urea, how do you think this occurs?

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd