Homologous proteins - amino acid sequence in fasta format, Biology

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 

Posted Date: 3/7/2013 5:26:39 AM | Location : United States







Related Discussions:- Homologous proteins - amino acid sequence in fasta format, Assignment Help, Ask Question on Homologous proteins - amino acid sequence in fasta format, Get Answer, Expert's Help, Homologous proteins - amino acid sequence in fasta format Discussions

Write discussion on Homologous proteins - amino acid sequence in fasta format
Your posts are moderated
Related Questions
Submission of evidence items to the forensic laboratory requires that a specific "Evidence Submission Request Form" be completed. What information should be included on the form?

Importance of pituitary gland Pitutary gland is very small and it is about the size of a large pea seed. It is very important as it controls the functions of all the othe

Primitive Arthropods The primitive arthropods, Onychophora (for example Peripatus) have a series of paired legs which are not jointed but have a ringed appearance because of t

Byproducts of low digestibility and low nitrogen Straws, husks, pods and haulms are the byproducts of this category. Very often the nitrogen content in these byproducts is so l

Q. Explain Treatment of Acute pericarditis? Symptomatic Treatment Pain relief can be achieved with indomethacin 25 to 50 mg. thrice daily; Ibuprofen 600 mg. thrice daily

Cardiac Output - Circulation The cardiac output can be determined in a number of ways. The most common method is the Fick's principle. A. Fick a German physiologist in 1870 de

Energy Input in Ecosystem Survival and functioning of ecosystem is dependent on the input of energy. Continuous availability of energy is essential for supporting diverse ecos

Normal 0 false false false EN-IN X-NONE X-NONE MicrosoftInternetExplorer4

Define Clinical Significance and Risk Factors for Drug-Nutrient interactions? We are already aware of the fact that poor nutritional status can impair drug metabolism and the d

Q. Describe IMZ Implant System? Then came the IMZ Implant System (Interpore IMZ) in 1974. The major difference between the IMZ System and all other relevant implant systems is