Homologous proteins - amino acid sequence in fasta format, Biology

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 

Posted Date: 3/7/2013 5:26:39 AM | Location : United States







Related Discussions:- Homologous proteins - amino acid sequence in fasta format, Assignment Help, Ask Question on Homologous proteins - amino acid sequence in fasta format, Get Answer, Expert's Help, Homologous proteins - amino acid sequence in fasta format Discussions

Write discussion on Homologous proteins - amino acid sequence in fasta format
Your posts are moderated
Related Questions
What is Cilia and Flagella? The surfaces of many eukaryotic cells bear cilia or flagella, built from specialized microtubules. Cilia are tiny brushlike hairs, and flagella are

How to reduce the stresses on the implant i) There is need to reduce the stresses on the implant - ii) Frequent recall for maintenance or hygiene appointments. iii) Gingi

why cerebellum more developed in mammals that jump or fly?

FUNCTIONS OF CELL WALL 1.       Provides shape to plant cell rigidity to cells. 2.       Functions as a barrier to entry of pathogens into the cells. 3.       Provides pr


Explain the Dietary Management of Sepsis and MODS? Patients suffering from sepsis and/or resultant multiple system organ dysfunctions are critically ill and admitted in the int

What problem would most likely to occur if a haploid cell attempted to perform meiosis? The cell could not replicate its DNA prior to meiosis.The cell could not pair homologous

how is an increase in glucose concentration controlled in the human body?


Sulphur Cycle - Nutrient Cycles The sulphur cycle is mostly sedimentary except for a short gaseous phase. The large reservoir of sulphur is in the soil and sediment where it i