Homologous proteins - amino acid sequence in fasta format, Biology

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 

Posted Date: 3/7/2013 5:26:39 AM | Location : United States







Related Discussions:- Homologous proteins - amino acid sequence in fasta format, Assignment Help, Ask Question on Homologous proteins - amino acid sequence in fasta format, Get Answer, Expert's Help, Homologous proteins - amino acid sequence in fasta format Discussions

Write discussion on Homologous proteins - amino acid sequence in fasta format
Your posts are moderated
Related Questions
1. Biogas is produced by the activity of aerobic bacteria on animal waste 2. Methanobacterium is an aerobic bacterium found in rumen of cattle 3. Biogas, commonly called goba

Size of Ecosystem As you know an ecosystem may be as small and as simple as a cow dung pad or as complex and large as an ocean or the biosphere itself, comprising a wide variet

what are the characteristics of algae?

Find the electric potential, taking zero at infinity, at the upper right corner (the corner without a charge) of the rectangle in the figure. (Let y = 3.7 cm and x = 6.7 cm.)

How are the male gametophytes and the male gametes formed in angiosperms? In the anthers of every stamen there are pollen sacs. Within the pollen sacs there are microspore moth

A L VEOL I - Sac like structure, unit of lungs. Increase surface area, exchange of gases occur in it. Rich in blood capillaries. Aloeoli join by pore of Kuhn to form a

explain glycolysis briefly? elaborate

Horizontal Chart: Horizontal chart which read from left to right are occasionally used. The pyramid lies horizontally instead of standing in the vertical position. The line of

Subphylum Mastigophora One or more flagella present in adult stages; autotrophic or heterotrophic nutrition; reproduction usually asexual by fission. Class - Phytomasti

Aortic Valve replacement :  The initial steps of the operation have been described earlier. Ascending aorta is cannulated. A single two-stage atrio-venous cannula is inse