Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Uricotelic excretion essential for avian and reptile embryos, Why is the ur...

Why is the uricotelic excretion essential for avian and reptile embryos? In reptiles and birds the excretory system is uricotelic as uric acid is insoluble, less toxic and sui

Cancer, What is Cancer? Besides AIDS, Cancer is another deadly human di...

What is Cancer? Besides AIDS, Cancer is another deadly human disease of our times about which people are panicky all over the world. It is estimated that one in every three per

Dna, diagram of dna replication

diagram of dna replication

Stomatal resistance, Stomatal Resistance Stomatal resistance is most i...

Stomatal Resistance Stomatal resistance is most important because gas exchange between leaves and external atmosphere takes place entirely through stomatal pores. Stomatal res

Fats requirement in diabetes, Q. Fats requirement in diabetes? Fats: Th...

Q. Fats requirement in diabetes? Fats: The total fat recommended by WHO is less than 30% of the total calories. However in view of the widely prevalent Asian paradox in India,

Risk of embolization, Systemic embolization occurs in 22 per cent to 50 per...

Systemic embolization occurs in 22 per cent to 50 per cent of cases of IE. Emboli often involve major arterial beds, including lungs, coronary arteries, spleen, bowel, and extremit

How are radioactive probes useful in dna fingerprinting, How are radioactiv...

How are radioactive probes useful in DNA fingerprinting? Radioactive probes bind to specific fragments in a DNA sample like a donor gene. A probe can identify which bacteria ha

What is the nucleolus, What is the nucleolus? The nucleolus is a small ...

What is the nucleolus? The nucleolus is a small and optically dense region in the interior of the cell nucleus. It is made of ribosomic RNA (rRNA) and proteins. Single nucleus

Define role of zinc in controlling gene expression, Define role of Zinc in ...

Define role of Zinc in controlling Gene Expression? Zinc atoms have specific structural roles in enzyme molecules, as well as, in many other proteins and in bio membranes. Thes

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd