Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Protozoa, What are the disadvantages of protozoa

What are the disadvantages of protozoa

What do you mean by a dihybrid cross, A dihybrid cross: Determines the gene...

A dihybrid cross: Determines the genetic makeup of an organism always involves homozygous alleles. Always involves organisms that are heterozygous at all loci. Always involves alle

Do the arteries that carry blood from the heart to the lungs, Do the arteri...

Do the arteries that carry blood from the heart to the lungs have arterial or venous blood? What happens to the blood when it passes through the lungs? Arteries of the pulmonar

Explain the working of human visual system, Q. Which is the part of the hum...

Q. Which is the part of the human visual system where the receptors that sense light, i.e., the photoreceptor cells, are located? How do those cells work? The photoreceptor cel

Chemical agents available for sterilization, Q. Chemical Agents Available f...

Q. Chemical Agents Available for Sterilization? Chemical Agents: these include the following: Alcohols: ethyl alcohol, isopropyl alcohol, trichlorobutanol Aldehydes: f

Diagram and describe the signalling of toll, Diagram and describe the signa...

Diagram and describe the signalling of toll like receptors and the resulting cytokines.

What is the kind of life cycle present in pteridophytes, Q. What is the kin...

Q. What is the kind of life cycle present in pteridophytes? Like all plants pteridophytes present diplobiontic (alternation of metagenesis or generations,) life cycle.

Bacterial diseases- braxy, Braxy The causative agent of braxy is Cl. s...

Braxy The causative agent of braxy is Cl. septicum. It usually affects lambs. The agent is a normal inhabitant of soil and is frequently found in the faeces of herbivores. Bra

Preparation for hospitalization of child - nursing, Preparation for Hospita...

Preparation for Hospitalization   Prevention is a strong component of nursing care. Preparation prior to hospitalization is  essential to make the transition from home to hospi

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd