Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Define the historical process of spatial processes, Define the Historical P...

Define the Historical Process of Spatial processes? In year 1952 Alan Turing developed his theory of the generation of pattern in systems of reaction diffusion equations, now k

Explain the alterations occurring in egg, Alterations occurring in egg ...

Alterations occurring in egg The quality, flavour, composition and functional properties of eggs are adversely affected more rapidly and to a greater extent by the speed and co

Synergistic contribution of malnutrition to child mortality, Explain Synerg...

Explain Synergistic Contribution of Malnutrition to Child Mortality? The synergistic contribution of malnutrition to child mortality is consistent across populations and can be

What chromosome condition is created, Following fertilization by a normal s...

Following fertilization by a normal sperm, what chromosome condition is created?

What is the energy efficiency of photosynthesis, What is the energy efficie...

What is the energy efficiency of photosynthesis? a) What area is occupied by each molecule? b) Calculate the molecular absorption cross section in units of A 2   A cr

Chiropterophily - cross-pollination, Chiropterophily - Cross-pollination ...

Chiropterophily - Cross-pollination Pollination brought about by bats is called cheiropterophily. Bats which feed at night and do not see very well, are frequent pollinators i

Pulsatile perfusion-type of blood pump, Pulsatile Perfusion: Conventional...

Pulsatile Perfusion: Conventional pumps give continuous flow with very little pulsatile property. Pulsatile perfusion is likely to result in better post operative renal and cardi

Urea, notes on urea

notes on urea

What is growth monitoring of an infant, What is Growth Monitoring? In t...

What is Growth Monitoring? In third world countries, about half the children are short and underweight for their age. Inadequate nutrient intake is the main reason. Inadequate

Process of conducting system of the heart, Impulses reaching the AV node fr...

Impulses reaching the AV node from the atria are delayed a little as they pass through the trunk and crura. The impulses first reach the papillary muscles and their contraction clo

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd