Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Determine the occurrence of folic acid, Occurrence of folic acid Folic...

Occurrence of folic acid Folic acid is an active principle widely occurring in the animal and vegetable kingdom. Richest sources are liver, dark green leafy vegetables, bean

Explain the regulation of blood glucose concentration, Explain the Regulati...

Explain the Regulation of Blood Glucose Concentration? A number of mechanisms function to maintain blood glucose at remarkably constant level of 70-100 mg/dl under fasting cond

What are similarities between proteins, What are some similarities between ...

What are some similarities between proteins, carbohydrates, and nucleic acids?

What is tubal pregnancy, Q. What is tubal pregnancy? Many times fecunda...

Q. What is tubal pregnancy? Many times fecundation takes place in the Fallopian tubes in general the newly formed zygote is taken to the uterus where nidation and the embryonic

What is the resting membrane voltage of the neuron, What is the resting mem...

What is the resting membrane voltage of the neuron A complete motor neuron is removed from a frog and placed in normal physiological saline at 1 AM. The neuron is healthy. At

Explain relative quantitative difference of protein taxonomy, Explain Relat...

Explain Relative Quantitative difference of Protein Taxonomy This analysis involves the study between the amounts of different proteins and more significantly, of different con

Can you explain nerves, Q. What are nerves? Axons extend all through th...

Q. What are nerves? Axons extend all through the body inside nerves. Nerves are axon-containing structures presenting many axons and covered by connective tissue. The nerves co

In what ways does over gazing lead to soil erosion?, Ask In what ways does ...

Ask In what ways does over gazing lead to soil erosion?

What is particularly of the mucous membranes, How would carbon monoxide poi...

How would carbon monoxide poisoning affect a person's coloring, particularly of the mucous membranes? How would it affect the hemoglobin concentration, hematocrit, and percent oxyh

Helobial type - endosperm, Helobial Type - Endosperm This type of endo...

Helobial Type - Endosperm This type of endosperm is intermediate between the nuclear and the cellular types. The division of the primary endosperm nucleus is followed by the f

Write Your Message!

Name

Email id

Message

Verfication Code

User Account

All Pages