Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

What is the host factors of implants, What is the Host Factors of implants ...

What is the Host Factors of implants These factors are very important and it is essential for the clinician to keep these in mind during the diagnosis and treatment planning st

Explain the process of determination of vitamin C, Determination of vitamin...

Determination of vitamin c Majority of chemical methods of determination is based on the rapid oxidation of ascorbic acid and therefore not too highly specific. Titration of

State in brief about respiration, State in brief about respiration When...

State in brief about respiration When we breathe in the air, our chest expands and air is taken in the lungs and when we breathe out chest returns to its resting position. This

Objective of nutritional management of hypertension, Q. Objective of nutrit...

Q. Objective of nutritional management of hypertension? The objective of nutritional management of hypertension includes: • To achieve gradual weight loss in overweight and

Describe class diplopoda and chilopoda in detail, Describe Class Diplopoda ...

Describe Class Diplopoda and Chilopoda in detail? Members of the Subphylum Crustacea and the Subphylum Uniramia have one major characteristic in common. Both groups have biting

Define observation or inference for picric acid test, Define observation or...

Define observation or inference for picric acid test? 1. A mahogany red colour will be seen. The mahogany red colour indicates the presence of reducing sugar. All monosaccharid

Mineral availability of organic mineral complexes, Mineral availability of ...

Mineral availability of organic mineral complexes A number of mineral chelates and complexes are available from a variety of manufacturers. A chelate is described as a metal c

Cartoon, A dialogue and cartoon between haemoglobin and chlorophyll

A dialogue and cartoon between haemoglobin and chlorophyll

Restriction endonuclease, Suppose the restriction endonuclease HindIII cuts...

Suppose the restriction endonuclease HindIII cuts a6.0 kb linear piece of DNA into two fragments; an 800 bp fragment and a 5200 bp fragment..... Question: Suppose restriction

What is pulmonary veins in normal pulmonary vasculature, Q. What is Pulmona...

Q. What is Pulmonary Veins in Normal Pulmonary Vasculature? The right and left upper lobe or superior pulmonary veins descend lateral to the arteries, cross in front of the hil

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd