User Account

All Pages

Determine the total charge for each peptide

Assignment Help Chemistry
Reference no: EM131706785

Question - Three polypeptides listed below are in a mixture. Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly (i.e. elute first) through a strong anion-exchange resin at pH 7.0?

ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG

GPYFGDEPLDVHDEPEEG

PHLLSAWKGMEGVGKSQSFAALIVILA

Reference no: EM131706785

Questions Cloud

Describe the structure of a glycogen molecule : Glycogen metabolism - Describe the structure of a glycogen molecule. What is the advantage of its branched structure
Transition from this excited state to the ground state : What is the wavelength of the radiation emitted when an atom of Al undergoes a transition from this excited state to the ground state?
Analyze the restrictions on arbitrage transactions imposed : Analyze the restrictions on arbitrage transactions imposed by federal regulations and potential consequences for violation of the regulations.
Describe the taft-hartley act : What restrictions are placed on union officers by the Taft-Hartley Act and the Labor Management Reporting and Disclosure Act amendments to the NLRA?
Determine the total charge for each peptide : Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly through a strong anion-exchange resin at pH 7.0
Suggest an intracellular regulatory molecule : Suggest an intracellular regulatory molecule that growth factors might stimulate to control cell division. Please describe how it works?
Discuss addicted to pornography or stealing : Contrast the difference between someone who is addicted to heroin verses someone who is addicted to pornography or stealing
Representation to the discharged postal worker : However, the union's general counsel advised against arbitration on the ground that there was little likelihood of success.
Determining the genotypes of the parents : Please assist him by determining the genotypes of the parents and all of the offspring. Express the genotypes both symbolically and in words.

Reviews

Write a Review

Chemistry Questions & Answers

  Explain the central c-c bond to be the gauche conformation

Conformational studies on ethane-1,2-diol (HOCH2-CH2OH) have shown the most stable conformation about the central C-C bond to be the gauche conformation, which is 9.6 kJ/mol (2.3 kcal/mol) more stable than the anti conformation

  Compute the ph after volumes of titrate have added

Consider the titration of 30.0mL of 0.050M NH3 with 0.025M HCl. Calculate the pH after the following volumes of titrate have added.

  What mass of magnesium will react

what mass of magnesium will react wait a 500.0mL container of oxygen at 150.0 degrees Celsius at 70.0 kPa?

  Define carboxylic acid under similar conditions

You can make an ester from a carboxylic acid as well as an alcohol or hydrolyze an ester to the corresponding alcohol as well as carboxylic acid under similar conditions but at identical temperatures.

  Calculate approximately the ability of ibuprofen

Determine why would the P have been higher or lower if the H 2 O had been at pH 5?

  Explain the product of furan as well as maleic anhydride

The product of furan as well as maleic anhydride in diethyl ether reacts at room temperature moreover forms the exo products as the major product. This product decay at its melting point while most other Diels Alder adducts with maleic anhydride d..

  What happened when caco3 was combined with hydrochloric

what happened when caco3 was combined with hydrochloric acid? was a chemical reaction obvious here ? what about naoh

  Calculate the total pressure

A 2.63 L flask is filled with carbon monoxide at 27°c until the pressure is 6.72 ATM. Calculate the total pressure after 2.89 moles of carbon dioxide has been added to the flask.

  Write structures for acetone

Write structures for acetone, a ketone, and methyl ethanoate, an ester.

  Explain epsom salt is a hydrate with a formula mgso4.xh2o

Epsom salt is a hydrate with a formula MgsO4.xH2O, where x indicates the number of moles of H2O per mole of MgSO4. After a 1.687 g sample of the hydrate is heated, 0.824 of MgSO4 remains. How many molecule of water are present per formula unit of ..

  Explain a single celled animal lives in a fresh water lake

A single celled animal lives in a fresh water lake. The cell is transferred into ocean water. Does it stay the same, shrink, or burst. Explain why.

  Define net redox reaction and explain the diagram

write the half reactions (reactions at Anode and Cathode) and net redox reaction and explain the diagram

Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

Submit Assignment

Academics

Major Subjects

Majors

Get In Touch

whatsapp: +1-415-670-9521

Phone: +1-415-670-9521

Email: [email protected]

TERMS & POLICIES

HELP & SUPPORT

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd