Design a peptide vaccine

Assignment Help Business Management
Reference no: EM132389042

To design a peptide vaccine to a) induce CTLs or b) induce antibodies from the "following sequence", which regions would you choose? Assume you will test in H2-Db mice.

LPKSFDARVEWPHCPSISEIRDQSSCGSCWAFGAVEAMSDRICIKSKGKHK PFLSAENLVSCCSSCGMGCNGGFPHSAWLYWKNQGIVTGDLYNTTNGCQP YEFPPCEHHVIGPLPSCDGDVETPSCKTNCQPGYNIPYEKD

To induce CTLs, the regions should be "dominant peptide regions". And for part b, to induce antibodies, the regions should be "hydrophilic/exposed" regions. But a detailed explanation would be appreciated.

Reference no: EM132389042

Questions Cloud

What happens if you have identical sequences : In general, what amount of diversity do you want in DNA sequences that will be used in a phylogenetic analysis?
Additional lymph node dissections in the axillary region : How have Scientists have always dissected lymph nodes nearby a cancerous tumor to see if the cancer has begun to spread to other areas of the body.
Prepare a reserach paper on feasibility of multi-zone hvac : Prepare a Reserach paper on Feasibility of Multi-zone HVAC systems in Residential Buildings. Evaluate the credibility and reliability of information sources.
What is the most southernmost peat bog in canada : What is the most southernmost peat Bog in Canada? What happened in this Bog in 2016? For which important reptile does it provide habitat?
Design a peptide vaccine : To design a peptide vaccine to a) induce CTLs or b) induce antibodies from the "following sequence", which regions would you choose? Assume you will test in H2-
Describe the different processes of learning : Learning can be broken down into four different processes. These processes include inputting information, integrating or organizing information in the brain.
Explain how the cell reproduction rate and differentiation : Explain how the cell reproduction rate and differentiation are kept within the normal range to avoid the formation of breast cancer cells.
Identify the method of regulation that is used : Identify the method of regulation that is used in each example.
How will you handle all the given expectations : Reflect on your skills in the area of teaching reading and what the emphasis on the early identification of children with potential reading problems means.

Reviews

Write a Review

Business Management Questions & Answers

  Caselet on michael porter’s value chain management

The assignment in management is a two part assignment dealing 1.Theory of function of management. 2. Operations and Controlling.

  Mountain man brewing company

Mountain Man Brewing, a family owned business where Chris Prangel, the son of the president joins. Due to increase in the preference for light beer drinkers, Chris Prangel wants to introduce light beer version in Mountain Man. An analysis into the la..

  Mountain man brewing company

Mountain Man Brewing, a family owned business where Chris Prangel, the son of the president joins. An analysis into the launch of Mountain Man Light over the present Mountain Man Lager.

  Analysis of the case using the doing ethics technique

Analysis of the case using the Doing Ethics Technique (DET). Analysis of the ethical issue(s) from the perspective of an ICT professional, using the ACS Code of  Conduct and properly relating clauses from the ACS Code of Conduct to the ethical issue.

  Affiliations and partnerships

Affiliations and partnerships are frequently used to reach a larger local audience? Which options stand to avail for the Hotel manager and what problems do these pose.

  Innovation-friendly regulations

What influence (if any) can organizations exercise to encourage ‘innovation-friendly' regulations?

  Effect of regional and corporate cultural issues

Present your findings as a group powerpoint with an audio file. In addition individually write up your own conclusions as to the effects of regional cultural issues on the corporate organisational culture of this multinational company as it conducts ..

  Structure of business plan

This assignment shows a structure of business plan. The task is to write a business plane about a Diet Shop.

  Identify the purposes of different types of organisations

Identify the purposes of different types of organisations.

  Entrepreneur case study for analysis

Entrepreneur Case Study for Analysis. Analyze Robin Wolaner's suitability to be an entrepreneur

  Forecasting and business analysis

This problem requires you to apply your cross-sectional analysis skills to a real cross-sectional data set with the goal of answering a specific research question.

  Educational instructional leadership

Prepare a major handout on the key principles of instructional leadership

Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd