Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Assignment, for making the assignment

for making the assignment

Typical network management system, Problem 1: List measurable entities ...

Problem 1: List measurable entities on which the quality of service in a data communication network depends Problem 2: Show the features of a typical Network Management

Why is this setup not secure, Question: a) You are using Active Directo...

Question: a) You are using Active Directory Users under Windows Server 2003 and Computers to configure user objects in your domain, and you are able to change the address and

Function of key secrecy and algorithm secrecy in security, What is the func...

What is the function of key secrecy and algorithm secrecy in security?  Algorithm Secrecy is explained as follows: ‘Algorithm secrecy’ is a method of keeping an algorithm

List vulnerabilities of using wep, Question: The Wired Equivalent Priv...

Question: The Wired Equivalent Privacy (WEP) standard was created in order to give wireless networks safety and security features similar to that of wired networks. (a) L

Access control matrix, You are provided with 3000 sample keystrokes for 5 u...

You are provided with 3000 sample keystrokes for 5 users mentioned above. You can find this data using the ‘Lab 2 User Data' link in the ‘Lab 2' folder on Blackboard. Please note t

Nyquist capacity theorem, (a) Illustrate what you understand by Nyquist Cap...

(a) Illustrate what you understand by Nyquist Capacity Theorem? (b) Consider we wish to transmit at a rate of 64 kbps over a 4 kHz noisy but error-free channel. What is the mini

Steganography-cryptography, Steganography It is a process of hiding info...

Steganography It is a process of hiding information in use for a long time. Most popular modern version of this process hides information within files appearing to contain digit

What type of rfid tag is more appropriate for ws-pass, Consider the followi...

Consider the following case study: In order to avoid criticisms of their existing manned road-toll payment system on its private road, WS-Pass has decided to adopt an automated

What is internet, The Internet is known as the set of networks connect...

The Internet is known as the set of networks connected by routers that are configured to pass traffic among any machine attached to any network in the set. By internet several

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd