Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

What is an autonomous system, QUESTION 1: a) Differentiate between a r...

QUESTION 1: a) Differentiate between a routing protocol and a routed protocol. b) Describe any three design goals of Routing protocols. c) Lists some of the features shared

Address resolution techniques, Address resolution algorithms may be grouped...

Address resolution algorithms may be grouped into three basic types: Table lookup Closed-form computation Message Exchange 1. TABLE LOOKUP: In Table Loo

Define the term enterprise network, a) Define the term "Enterprise Network"...

a) Define the term "Enterprise Network". b) Briefly discuss the similarity and differences between a switch and a router. c) A company XYZ has been renting the 1 st Floor of

Address resolution protocol (arp), ADDRESS RESOLUTION PROTOCOL (ARP) T...

ADDRESS RESOLUTION PROTOCOL (ARP) TCP/IP can use any of the three address resolution functions relaying on the addressing procedure used by the underlying hardware. To guarant

Meaning of dns - domain name system, What do you understand by the DNS? Exp...

What do you understand by the DNS? Explain the usage of the resource rec or ds. Domain Name System is described below: The Domain Name Service (DNS) is the hierarchi

Address masks, ADDRESS MASKS To identify receiver, network apply addre...

ADDRESS MASKS To identify receiver, network apply address mask to receiver address and calculate to network address in routing table. It can use Boolean 'and' to calculate the

What do you meant by network address translation, Problem: (a) What do ...

Problem: (a) What do you meant by Network Address Translation (NAT)? Why is it used? (b) Given the following information by your ISP about your newly acquired Frame Relay c

Ip datagram format, IP DATAGRAM SIZE:  Datagrams may have different si...

IP DATAGRAM SIZE:  Datagrams may have different sizes i.e. Header area is generally fixed (20 octets) but can have various options. Data area may contain between 1 octet and 6

Evaluate the percentage availability of the network, QUESTION a) "Two ...

QUESTION a) "Two of the key attributes of an enterprise network is that it have to be multi-platform and multisite." Decribe what you understand by this statement. b) A

CS, Discuss how developers should apply the following countermeasures to im...

Discuss how developers should apply the following countermeasures to improve the security of their code:

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd