Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Compare and contrast between block and stream ciphers, Problem 1 Solve ...

Problem 1 Solve the following Caesar cipher by showing your working: EM KIUM EM AIE EM KWVYCMZML Problem 2 Compare and contrast between block and stream ciphers, listin

Computer security, For this assessment, students must research and analyse ...

For this assessment, students must research and analyse two different scenarios. The two scenarios must be chosen from those described below and submitted as one Microsoft PowerPoi

Wfabilling project in java, WFABilling project in Java:  Project Title...

WFABilling project in Java:  Project Title: WFABilling   Role                      : Developer Domain                 : Tele-Com Environment          : Java, J2EE, S

Secure a wireless network, Secure a Wireless Network WIRELES Most onli...

Secure a Wireless Network WIRELES Most online retailers provide some type of privacy statement. Many statements are long, and appear in small print, and many appear to be simi

Define broadcasting , Broadcasting is the distribution of video and audio...

Broadcasting is the distribution of video and audio content to a whole audience via any audio or visual mass communications medium, but generally one using electromagnetic radiat

Vulnerability scanners, VULNERABILITY SCANNERS Active vulnerability scan...

VULNERABILITY SCANNERS Active vulnerability scanners scan networks for detailed information, it initiate traffic to determine security holes. This scanner identifies usernames a

Extended euclidean algorithm, (a) Using the extended Euclidean algorithm, ...

(a) Using the extended Euclidean algorithm, find the multiplicative inverse of 504 mod 67. (b) Decrypt the following ciphertext, which has been encrypted using Caesar cipher:

Describe types of communication impairments, Question : (a) "Pulse Code...

Question : (a) "Pulse Code Modulation (PCM), as used in telephony, samples a signal at 8 kHz using 256 quantization levels". Outline how this scheme works with the help of ske

Introduction to security and personnel, INTRODUCTION TO SECURITY AND PERSON...

INTRODUCTION TO SECURITY AND PERSONNEL When implementing information security, there are several human resource issues that should be addressed. They are •    Positioning and n

What are the main objectives of a risk analysis, QUESTION 1 Risk ana...

QUESTION 1 Risk analysis helps companies prioritize their risks and shows management the amount of money that should be applied to protecting against those risks in a sensib

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd