Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Base lining-risk management, Base lining •    Organizations do not have ...

Base lining •    Organizations do not have any contact to each other •    No two organizations are identical to each other •    The best practices are a moving target •    K

Explain how the key exchange algorithm works, Question: (a) Explain how...

Question: (a) Explain how the Diffie-Hellman key establishment protocol works. (b) Prove that the Diffie-Hellman key establishment protocol is vulnerable to a `man in the mi

CNSS, Assume that a security model is needed for the protection of informat...

Assume that a security model is needed for the protection of information in your class. Using the CNSS model, examine each of the cells and write a brief statement on how you would

Direct sequence modulation, Question 1 a) Provide three advantages of ...

Question 1 a) Provide three advantages of using optical fiber. b) Distinguish between "Direct Sequence Modulation" and "Frequency Hopping" c) Decribe the purpose of using "

Describe briefly an artificial intelligent technique, Question : (a) W...

Question : (a) What is an IDS and what is the basic problem it faces which can be solved by Artificial Intelligence. (b) Identify and describe briefly an Artificial Intell

Html, how to link html with a data base

how to link html with a data base

Distinguish between a mobile agent state and code, Question: (a) Disti...

Question: (a) Distinguish between a mobile agent "state" and "code". (b) Differentiate between "weak" and "strong" mobility. (c) Mobile agent systems are known to have

Describe privacy-protecting techniques, Question: a) What do you meant...

Question: a) What do you meant by Privacy? b) Name the four privacy violations. c) Often, aggregate information and anonymized information can be combined to identif

What do you understand by the term integrity, Question: (a) What do yo...

Question: (a) What do you understand by the term "integrity"? (b) Which type of attack denies authorized users access to network resources? (c) You have discovered tha

Explain the operation of the matchmaker middle agent, Question 1: (a) E...

Question 1: (a) Explain the operation of the "matchmaker" middle agent. (b) Describe why broker middle agents are more efficient in terms of the time taken for a service to

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd