Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Explain the concept of zero knowledge proofs, (a) Describe the concept of ...

(a) Describe the concept of zero knowledge proofs. Give a practical example. (b) Explain how a one way hash function works. (c) What are message authentication codes? (d)

Explain what is software debouncing, Question : (a) How does a 2-key r...

Question : (a) How does a 2-key rollover differ from the N-key rollover? (b) Why is isolation so important in interfacing? (c) Explain what is software debouncing.

Implement security measures, Problem (a) Give two reasons for companie...

Problem (a) Give two reasons for companies to implement security measures. (b) What is the regulatory expectation regarding i. healthcare information, ii. financial

Assignment, for making the assignment

for making the assignment

Explain the purpose of the dr and bdr, QUESTION a) Compare and contras...

QUESTION a) Compare and contrast between static and dynamic routing. b) What are the merits (five merits) and limitations (3 limitations) of using Open Shortest Path First

Nstissc security model, NSTISSC SECURITY MODEL The NSTISSC Security Model ...

NSTISSC SECURITY MODEL The NSTISSC Security Model provides a detailed perspective on security. While the NSTISSC model covers the 3 dimensions of information security, it removes

Provide a labelled drawing of a standard serial port, Question 1: (a) W...

Question 1: (a) With the help of a diagram show the basic structure of a computer system. (b) Explain as fully as you can each of the parts mentioned above. (c) What are

Representation of a tcp header, (a) Figure is a representation of a TCP hea...

(a) Figure is a representation of a TCP header. For each of the fields lettered from A to G, state the name of the field and provide a brief explanation for the function of each fi

Information and network security, Information and Network Security Part ...

Information and Network Security Part 1- Recovery of an encrypted `word' using a forward search attack. Complete and correct summary for part 1. Adequately commented, clea

Improving domain blacklisting - spam mail, Improving domain blacklisting: ...

Improving domain blacklisting: Current domain blacklisting techniques are not very effective as spammers keep replacing blacklisted domains with newly registered domains. Also

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd