Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Ethical hacking penetration testing, Get a copy of Metasploitable at Make...

Get a copy of Metasploitable at Make">http://sourceforge.net/projects/metasploitable/files/Metasploitable2/ Make sure to follow these directions very carefully. You will get po

Designing and coding of job search mechanism, Designing and coding of Job s...

Designing and coding of Job search mechanism: Project Title: FREEHIVE (Sep 2005- Nov 2006) Role             : Developer Domain         : Social Network Client

Application-based ids, Application-Based IDS Application-based IDS (AppI...

Application-Based IDS Application-based IDS (AppIDS) is an advanced version of HIDS. It examines application for abnormal events. The ability to view encrypted data is the uniqu

Point-to-point topology, POINT-TO-POINT: In Point-to-Point topology th...

POINT-TO-POINT: In Point-to-Point topology there are two kind of topologies. 1) STAR topology 2) TREE topology In star topology each and every computer is connect

Define repeater, Repeater known as regenerator ; it is an electronic mac...

Repeater known as regenerator ; it is an electronic machine that performs only at physical layer. It gets the signal in the network before it becomes loss or weak, recreates the

Categories of controls-risk management, Categories of Controls Controlli...

Categories of Controls Controlling risk through mitigation, avoidance or transference is accomplished by implementing controls. There are 4 effective approaches to select the co

Corresponding access control matrix, Consider a computer system with three ...

Consider a computer system with three users: Alice, Bob and Cindy. Alice owns the file alicerc, and Bob and Cindy can read it. Cindy can read and write the file bobrc, which Bob ow

Define packet, CONCEPT OF PACKET : Network systems splits data in small ...

CONCEPT OF PACKET : Network systems splits data in small junks or blocks known as packets, which they send individually. Why we required packets rather than bits? The answer to

Perimeter network security system, Title: Perimeter Network Security System...

Title: Perimeter Network Security System Outline Requirements The University is based in Glasgow, and provides higher education services to its students and staff. It is loc

Maximum transmission unit (mtu), Maximum Transmission Unit  (MTU) Eac...

Maximum Transmission Unit  (MTU) Each hardware method specification adds the definition of the maximum size of the frame data area, which is known the Maximum Transmission Uni

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd