Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

What do you understand by demilitarized zone, Problem 1: What does the ...

Problem 1: What does the SNMP access policy show? SNMP community diagram SNMP access policy Problem 2: Does there exist any formal functional specificat

Typical network management system, Problem 1: List measurable entities ...

Problem 1: List measurable entities on which the quality of service in a data communication network depends Problem 2: Show the features of a typical Network Management

Network management system, Question (a) Draw a typical hybrid star-rin...

Question (a) Draw a typical hybrid star-ring topology paying attention to how the clients and switching hubs are connected. (b) State 3 main differences between a router

Token ring, TOKEN RING Many LAN methods that are ring topology need to...

TOKEN RING Many LAN methods that are ring topology need token passing for synchronized access to the ring. The ring itself is acts as a single shared communication phase. Both

Explain why spreadsheets are so useful, Question: Spreadsheet packages ...

Question: Spreadsheet packages are widely used in Business. a) Explain why spreadsheets are so useful. b) Spreadsheet files are sometimes saved for use by other software

Wfabilling project in java, WFABilling project in Java:  Project Title...

WFABilling project in Java:  Project Title: WFABilling   Role                      : Developer Domain                 : Tele-Com Environment          : Java, J2EE, S

Risk control strategies-risk management, Risk Control Strategies Once th...

Risk Control Strategies Once the ranked vulnerability risk worksheet has created, they should choose one of following 4 strategies to control each risk: •    Apply safeguards wh

Develop a tcp-based client-server socket program, Develop a TCP-based clien...

Develop a TCP-based client-server socket program for transferring a large message. The message transmitted from the client to server is read from a large file (size is about 30000

Application layer protocol, Problem a) Give the destination IP address, up...

Problem a) Give the destination IP address, upper layer protocol, TTL in decimal and header checksum in hexadecimal; the source port number and the destination port number in deci

Asymmetric encryption-cryptography, Asymmetric Encryption Asymmetric encr...

Asymmetric Encryption Asymmetric encryption method makes use of two different but related keys and either key can be used to encrypt or decrypt the message. This method is freque

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd