Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Produce a packet from a wireshark capture, Question requires you to produce...

Question requires you to produce a pcap file from a Wireshark capture.  In addition, you must include a screen capture of Wireshark and some specific information regarding the fram

Cracking the Vigenere Cipher, The following message was enciphered with a V...

The following message was enciphered with a Vigenère cipher. aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs deusjgecmzkwvnreeyp

Explain the purpose of the dr and bdr, QUESTION a) Compare and contras...

QUESTION a) Compare and contrast between static and dynamic routing. b) What are the merits (five merits) and limitations (3 limitations) of using Open Shortest Path First

Designing and coding of job search mechanism, Designing and coding of Job s...

Designing and coding of Job search mechanism: Project Title: FREEHIVE (Sep 2005- Nov 2006) Role             : Developer Domain         : Social Network Client

Wireless local area network, a) Wireless local area network (WLAN) technol...

a) Wireless local area network (WLAN) technologies constitute a fast-growing market introducing the flexibility of wireless access into office, home, or production environments. G

Identify possible controls-information security, Identify Possible Controls...

Identify Possible Controls For each threat and linked vulnerabilities which have residual risk, create primary list of control ideas. Residual risk is the risk which remains to

Selecting a risk control strategy, Selecting a Risk Control Strategy Risk...

Selecting a Risk Control Strategy Risk controls involve selecting one of the 4 risk control strategies for every vulnerability. The flowchart is shown in the figure given below

Legal, LEGAL, ETHICAL AND PROFESSIONAL ISSUES To minimize liabilities an...

LEGAL, ETHICAL AND PROFESSIONAL ISSUES To minimize liabilities and reduce risks, information security practitioner should: •    to understand current legal environment •    to s

What is network address translation, Question: (a) What is Network Add...

Question: (a) What is Network Address Translation (NAT)? Why is it used? (b) Given a following information by your ISP about your newly acquired Frame Relay connection:

Network security in an organisation, Network security is an issue for compa...

Network security is an issue for companies regardless of whether they participate in electronic commerce; however, since most organizations have a Web site that allows some interac

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd