Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Digital certificates-cryptography, Digital Certificates Digital Certific...

Digital Certificates Digital Certificates are electronic document having key value and identifying information about entity which controls key. Digital signature which is attach

Internet protocol (ipv6), SUCCESS OF IP:  IP has accommodated dramatic...

SUCCESS OF IP:  IP has accommodated dramatic modification since real design. But basic rules are still appropriate today. There are many new kinds of hardware. SCALING:

How an attacker can effectively de-layer and analyse data, Around the globe...

Around the globe the bank controlled Co-ops (Visa, MasterCard, Discover, and American Express) have rolled out millions of smart cards under the EMV (Europay, MasterCard, VISA) sta

Digital certificates, A Certificate presents an organization in an official...

A Certificate presents an organization in an official digital form. This is same to an electronic identity card which serves the purpose of Identifying the owner of the certificate

Determine the codeword which is transmitted using crc, Question (a) For...

Question (a) For the bit stream 010011, show the waveforms for each of the code indicated. Consider that the signal level for NRZ-L for mark is positive; the signal level for t

What is ftam-file transfer access and management, Describe what the FTAM se...

Describe what the FTAM services are. FTAM  stand for the File Transfer Access and Management: FTAM is an ISO application protocol which performs the operations on files such as.

Corresponding access control matrix, Consider a computer system with three ...

Consider a computer system with three users: Alice, Bob and Cindy. Alice owns the file alicerc, and Bob and Cindy can read it. Cindy can read and write the file bobrc, which Bob ow

Difference between synchronous tdm and statistical tdm, Question (a) A CRC...

Question (a) A CRC is constructed to generate a 4-bit FCS for an 11-bit message. The divisor polynomial is X 4 + X 3 + 1 (i) Encode the data bit sequence 00111011001 using po

Address resolution with table lookup, ADDRESS RESOLUTION WITH TABLE LOOKUP ...

ADDRESS RESOLUTION WITH TABLE LOOKUP : Resolution needs data structure that has information about address binding. A distinct address-binding table is used for every physical n

Components of an information system, COMPONENTS OF AN INFORMATION SYSTEM ...

COMPONENTS OF AN INFORMATION SYSTEM The components of an information system are software, data, hardware, people, procedures and Networks. These 6 components are critical to ena

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd