Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Fragmentation, FRAGMENTATION One method is to limit datagram size to s...

FRAGMENTATION One method is to limit datagram size to smallest MTU of any server. IP needs fragmentation i.e. datagrams can be divided into pieces to fit in network with small

Find the capacity of the wcdma, Question: (a) Describe the term interfe...

Question: (a) Describe the term interference in the space, time, frequency, and code domain. (b) Consider a 1 G - AMPS: 824-849 MHz (forward) ; 869-894 MHz (reverse). B

Point to point transmission(ppp), Normal 0 false false fals...

Normal 0 false false false EN-US X-NONE X-NONE

Using icmp reachability, USING ICMP TO TEST REACHABILITY:  ICMP can a...

USING ICMP TO TEST REACHABILITY:  ICMP can also be used to test several tools. An Internet host A, is reachable from another host B, if data packets can be send from A to B. P

Direct point-to-point communication:, Early networks used simple point-to...

Early networks used simple point-to-point communication . In such a method of communication every communication channel connects exactly two devices. In this way it prepares a m

Provide a suitable network infrastructure for the campus, QUESTION a) ...

QUESTION a) Below is a capture of an Ethernet II frame which contains an IPv4 packet and a segment. Give the source MAC address in hexadecimal; the source IP address, the uppe

Fragmentation and path mtu, FRAGMENTATION AND PATH MTU IPv6 source is ...

FRAGMENTATION AND PATH MTU IPv6 source is responsible for fragmentation. Routers simply drop datagrams bigger than network MTU. So source have to fragment datagram to arrive d

Find the possible deciphering transformations, Question: (a) A string o...

Question: (a) A string of ciphertext was enciphered using an a±ne transformation of single letters in a 28-letter alphabet consisting of A to Z, a blank and a?, where A to Z ha

Calculate the minimum required signal strength, Question 1: (a) (i) Ra...

Question 1: (a) (i) Radio waves are subject to several propagation problems. Name any three of them. (ii) A Wi-Fi receiver requires a signal power of 50mW to operate correc

Network security, Network security has become much more complex than ever b...

Network security has become much more complex than ever before. New types and sources of network security threats, always-on high-speed Internet connections, wireless networking, a

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd