Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Digital signature, A digital signature is a stamp on the data, which is uni...

A digital signature is a stamp on the data, which is unique and very hard to forge.  A digital signature has 2 steps and creates 2 things from the security perspective. STEP 1

Describe the procedure known as byte stuffing, Question: (a) For the b...

Question: (a) For the bit stream 010011, sketch the waveforms for each of the code indicated. Assume the following: the signal level for the previous bit for NRZI was a 1

Describe the five-layer network using block diagrams, Problem 1: a) One...

Problem 1: a) One of the limitations of file processing systems is data inconsistency. Briefly explain with the help of an example what do you understand by this phrase. b)

Hashing, Hashing is the transformation of a string of characters into a g...

Hashing is the transformation of a string of characters into a generally shorter fixed-length key or a value that presents the original string. Hashing is used to index and retri

Internet protocol(ip), Internet Protocol IP Gives computer-to-comp...

Internet Protocol IP Gives computer-to-computer communication. Host and receiver addresses are computers. This is also known machine-to-machine communication.

What do you meant by network address translation, Problem: (a) What do ...

Problem: (a) What do you meant by Network Address Translation (NAT)? Why is it used? (b) Given the following information by your ISP about your newly acquired Frame Relay c

Information security policy practices and standards, INFORMATION SECURITY P...

INFORMATION SECURITY POLICY PRACTICES AND STANDARDS Management from all the communities of interest should consider policies as basis for all information security efforts. Polic

Draw the network layout, Question : a) Below is a capture of an Etherne...

Question : a) Below is a capture of an Ethernet II frame which contains an IPv4 packet and a TCP segment. Give the source MAC address for the frame in hexadecimal; the source I

ISDN, Explain the architecture of ISDN.....?

Explain the architecture of ISDN.....?

Meaning of dns - domain name system, What do you understand by the DNS? Exp...

What do you understand by the DNS? Explain the usage of the resource rec or ds. Domain Name System is described below: The Domain Name Service (DNS) is the hierarchi

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd