Identification of the protein name and organism

Assignment Help Biology

Reference no: EM131434757 , Length: word count:3000

1) Display the structures with VMD or Pymol and save informative snapshots.

2) Evaluate the model(s) from the parameters provided in the output of Swiss Modeller.

3) Evaluate the model(s) and template structures with Molprobity.

4) Using public repositories and servers comment on possible functions for the gene corresponding to the selected sequence.

5) Perform a TreeFam analysis. Discuss the domain architecture and the evolutionary relationships with homologous ones.Comparative Modelling and functional investigation of a protein with unknown structure.

This course work involves the analysis of structure and function properties derived from a given protein sequence (the UniProtKB/TrEMBL accession number or the FASTA file with the sequence will be given).

Practical exercise

Main steps of the exercise:

CORE exercise compulsory

1) Identification of the protein name and organism; retrieve sequence in FASTA format, or sequence identifier if the FASTA file is given.

This is your query sequence:Q6NTF7
>sp|Q6NTF7|ABC3H_HUMAN DNA dC->dU-editing enzyme APOBEC-3H OS=Homo sapiens GN=APOBEC3H PE=1 SV=3
MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV

2) Perform a Blast search with the target sequence for structure modelling (using PDB database of protein structures).

3) Retrieve Blast sequences.

4) Align the selected sequences with known structure(s) with T-coffee.

5) From the analysis in step 4 select the best template(s) for homology modelling, and justify your selection.

6) Perform automated homology modelling via web server: Swiss Modeller.

7) Download the template(s) used by the server and the model created by the server and e-mailed to you.

8) Compare the template(s) selected by the server and the one you would have selected based n the alignments and other criteria. Compare T-coffee alignments with Swiss Modeller alignments.

9) Perform the alignment mode homology modellling via web server: Swiss Modeller

10) Perform a comparison (structural, 3D superimposition) with the model deposited in the Modbase database (if any) and/or others if you find other deposited models.

11) Display the structures with VMD or Pymol and save informative snapshots.

12) Evaluate the model(s) from the parameters provided in the output of Swiss Modeller.

13) Evaluate the model(s) and template structures with Molprobity.

14) Using public repositories and servers comment on possible functions for the gene corresponding to the selected sequence.

EXTRA exercise

15) Perform a TreeFam analysis. Discuss the domain architecture and the evolutionary relationships with homologous ones.

Essay

Describe your observations during the main steps of the construction of the model in an essay-like document of 3000 words including figure legends and references.

The essay should include:

Introduction to the protein, analysis of the results, critical evaluation of the model and of the alignments. Discuss a possible function for the protein. Add essential plots, figures and analysis results in the essay, but they have to be INCLUDED within the total 3000 words limit.

You may add the alignments as an Appendix.

Suggestions

The essay should be written in your own words. Beware of Plagiarism. A charge of plagiarism results in the student getting zero for his or her poster and also potentially being disciplined by the College.

If you are unsure about what is plagiarism you must ask the module coordinator. Sources

The source material for your essay should be textbooks and scientific articles, and your own analysis of the results.

Use the library and/or literature searches (Medline, Pubmed, Google). The web can be useful for figures and diagrams. However material available on the web may not be of an appropriate standard and the accuracy cannot be easily checked. In addition the content of websites is continually changing, therefore a web-site address is not an adequate reference for the material used. You will be marked down if you only use websites.

You must list the sources of information (references) that you have used to generate your essay. You should be particularly aware of cutting and pasting the contents of a website into your essay. This is Plagiarism. If this is detected you will be given a zero mark.

Attachment:- Assignment.pdf

Reference no: EM131434757

Questions Cloud

Payment on a house : Jeremy Denham plans to save $4,896 every year for the next eight years, starting today. At the end of eight years, Jeremy will turn 30 years old and plans to use his savings toward the down payment on a house.

What type of air mass will be created if a batch of air sits : What type of air mass will be created if a batch of air sits over the equatorial pacifc ocean for a few days?What is the symbol for this air mass.

Analyze the impact of any recent social trend on health care : To start, select one of the following approved topics for your Senior Project. You may also have a topic of your choice approved by the instructor in Week One. Many of the approved topics have specific subtopics outlined and, while these topics a..

Important aspects in running a small business : It is often said that cash flow is one of the most important aspects in running a small business. If you were the manager of a small business and you made yearly repayments on a loan, would you rather make loan repayments at the beginning ofeach y..

Identification of the protein name and organism : Describe your observations during the main steps of the construction of the model in an essay-like document of 3000 words including figure legends and references.

Understand the risks of operating a small business : Know the benefits and risks of completion? Understand the risks of operating a small business? Know the basics of a business plan? se and interpret financial ratios? Know the various classifications of marketing?

Calculate the expected holding-period return : Calculate the expected holding-period return and standard deviation of the holding-period return. All three scenarios are equally likely. (Do not round intermediate calculations. Round your answers to 2 decimal places.)

What were the total cost and book value of property : What were the total cost and book value of property, plant, and equipment at September 27, 2014? Using the notes to find financial statements, what method or methods of depreciation are used by Apple for financial reporting purposes

Explain what psychological factor can often motivate hackers : Explain what psychological factors can often motivate hackers (eg, addiction, crime, greed, status, etc....), and give examples where these motivations were a factor in a cyberattack.

Reviews

len1434757

3/21/2017 2:54:52 AM

Comparative Modelling & functional investigation Word Count- 3000 Quality Words (Some part already done by the student) Analysis of the Results Critical evaluation of the model and of the alignments Discuss a possible function for the protein

Write a Review

Required(*) Message

User Account

All Pages