Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Q. What are the major events of the final mitotic period? The final mitotic phase is the telophase. In the telophase the following events occur decondensation of chromosomes ea


Explain the Theory or Principle of Determination of the Quality of Milk Milk is an ideal medium for the survival and growth of microorganisms. It contain all the nutrients, i.e

Q. As a result of the DNA replication two DNA molecules come into existence. Why is it not correct to assert that the two "new" DNA molecules are created? What is the name given to

green gland in prawn

Determine the Neuropsychological assessment  Neuropsychological assessment typically involves the functional areas of general intellectual capacities; memory; speed and accurac

What are the special anatomic considerations in posterior maxilla?  Posterior maxilla has very poor  quality of bone demanding special consideration in implant placement. These

What are immunoglobulins? Immunoglobulin is the exchange name given to antibody. Immunoglobulins are complex proteins having an invariable portion and a variable portion and ma

What does vacuoles do? It is an organelle, located in the cell's cytoplasm, which is the site of protein synthesis. It is really a protein having of 2 parts. These 2 "parts"

"Height" is an example of a gene, but "Short" is an example of...