Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Q. Symptoms of inflammatory bowel disease? Inflammatory bowel diseases are associated with: • Abdominal cramping, diarrhoea • Steatorrhoea • Obstruction caused due t

In Reggie's case, he fractured the proximal end of his right femur, an integral component of his hip. Name the joint disorders that Reggie is more a risk of in (a) the short term a

Define Briefly about the Manganese Toxicity? Manganese is considered least toxic of the trace minerals through oral intake. However, some people may be at a risk to develop tox

Ground Water Ground water represents a major subterranean reservoir of fresh water. In general. it is not tapped by plants as it is too deep and does not suffer from loss due t

Define About the Sterols - Non Glyceride Fractions? These constitule a major proportion of the non-glyceride component while tocopherols, carotene pigments and flavour compound

Spiracular Control - Respiration Normal 0 false false false EN-IN X-NONE X-NONE MicrosoftInternetExplorer4

Q. How is the respiratory system in aquatic molluscs characterized? What adaptive respiratory structure do terrestrial molluscs present? In terrestrial molluscs the rich vascul

Pressure calculation made using the Bernoulli equation may be used  in conjunction with pressure measurements made by other modalities to determine various intracardiac pressure.

Aeration A well-aerated soil is one in which gases are available to plant roots and other soil organisms, in sufficient quantities and in proper proportions to support their no

1. Explain the challenges and advantages of having internal gills over external gills for gas exchange? 2. Explain how increased stress levels can affect hormones which ultimate