Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Q. What is action mechanism of antibiotic penicillin? Penicillin, discovered by the Scottish doctor Alexander Fleming in 1928, is a drug that inhibits enzymes essential for the

Q Which are the molecules that make possible active transport during membranes? Active transport is prepared by specific membrane proteins. These proteins are known as "pumps"

true or false. the law of entropy says that all energy is ultimately derived from the sun

Q. Does the mitosis properly occur after or before the interphase? Is it a simple "point of view" issue? Mitosis have to be considered a succeeding phase after interphase since

Define Regulation of Water Balance - For the Digestive Process? For the digestive process alone, the estimated daily volume of fluid that enters and leaves the gastrointestinal

Starch It is a plant polysaccharide synthesized by  the plant by photosynthesis and stored mainly  in  grains,  legumes,  roots  and  tubers.  Its molecular formula is (C 6 H 1

What are the archenteron and the blastopore? What is the stage of the embryonic development in which these structures are formed? What are the destinations of the archenteron and o

Formation of cocoon in earthworm: In earthworm segments from 14 to 17 are swollen. Skin on these segments is thick and glandular. This is called clitellum. When ovaries ma

Ritonavir (RTV, Norvir)  Ritonavir is well absorbed  from the gastrointestinal tract and at full doses potently inhibits HIV, but due to poor tolerability it is now used mainly

Crisis due to Deforestation Due to continuing deforestation we are faced with a major ecological and socio-economic crisis. To reverse this trend of deforestation a National