Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
List four possible after-effects of solvent abuse (glue-sniffing). Possible after-effects of solvent abuse are headache, nausea, vomiting, convulsions, runny nose, a rash round

what is nomenalistic specie concept


Why is it difficult to produce efficient vaccines against a viral infection like dengue and AIDS? It is complex to make vaccines against dengue because there are four dissimila

What is the difference between haploid and diploid? why are so many anesthesias fat solvents Why is it important for core body temperature to stay more constant than skin tem

Features of Estuaries The physicochemical properties of the estuaries have large variation in several parameters and this often creates stressful environment for organisms. T

What are alleles of a gene? Diploid individuals have paired chromosomes. For instance in humans there are 23 pairs of chromosomes totalling 46 chromosomes. Each pair comprehend

Define the Basic Types of Drying Process? Primarily, there are three basic types of drying process: a) Sun drying and solar drying;  b) Atmospheric drying including batch

i want to extract my compound of interest from tlc i m finding some enzyme inhbitor from microbial source can you plzz suggest me how to prepare nad get my compound

Determine the extracellular concentration of TVA Consider Neuron B in the frog central nervous system whose plasma membrane has a previously unknown channel that is selectivel