Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Lysosomes Lysosomes are small vesicles which are bounded by a single membrane & contain hydrolytic enzymes in the form of minute crystalline or semi crystalline granules of

Q. What is Atomic constipation? This type is most common; often it is called the "lazy .bowel". There is a loss of muscle tone causing weak peristalsis, the causes are: a) L


Normal 0 false false false EN-IN X-NONE X-NONE MicrosoftInternetExplorer4

Define the term - Acoelomate Triploblastic animals which do not have an internal body cavity. This includes flatworms and ribbon worms. However the term could be applied to oth

Hepatitis A/B  A combination vaccine containing the same antigenic components as  Engerix-B and pediatric  Havrix (Twinrix - GlaxoSmithKline) is available for patients >18 year

Define about the Food Production? We know that agriculture comprises the major source of food production. This is very true in a country like ours where the majority of the pop

Q. Are body planes important for identifying anatomical structure? In order to observe and study structural arrangement of the internal organs, body may be divided and sectione

E l ec t r o c ar d i og r ap h y : This equipment is used to identify cardiac conduction abnormalities that limit heart perf

how does respiration in animals occur? what is respiration? what are the common types of respiration?