Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Which of the following serves as an effector, or as part of an effector, that functions in a negative feedback system? A. Muscarinic Acetylcholine Receptors (mAChRs) in the SA

Q. What are cerebrovascular accidents? The Cerebrovascular accident (CVA), as well known as stroke, is the generic name given to infarction (tissue and cellular death by hypoxi

How Age factors Affecting the calcium absorption? Age is another factor which influences the absorption of calcium. Fractional absorption of calcium is highest in infancy i.e.,

Q. What is the mitosis? What is the significance of mitosis? Mitosis is the process in which one eukaryotic cell divides into two cells identical to the parent cell generally i

Q. What are the main causes of the loss of biological diversity nowadays? The largest dangers to the biological diversity today are the action of humans. The major of them is t

Consequences of Air Pollution The physiological effects of toxic pollutants on living beings can be of two types: Acute effects and Chronic effects. Acute effec

Explain the Polycarbonate Nucleopore Filtre? A given sample is filtered through a membrane filter, usually polycarbonate nucleopore filter with a pore size that will retain bac

Disorders of Thyroid Function: The disorders of thyroid function may  lead to following problems:  Juvenile Hypothyroidism Hypothyroidism is one of the most common end

Early campaigns of the 19th century that focused on sanitation, hygiene, housing, and nutrition had little effect in controlling communicable disease due to flawed rationale based

Define Health Benefits of Other Dietary Factors with Antinutritional Effects? Despite the predominantly nutritional antagonistic effects of the factors described above, there i