Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Processing Methods for Amelioration of Anti-Nutritional Meals from many oil seeds often contain undesirable toxic and allergenic compounds that can reduce their nutritive valu

Define Can we improve the nutritive value of protein? Yes, as discussed above, the nutritive value of a protein can be improved in two ways: (1) by mutual supplementation, that

Sarcodine protozoans are amoebas, and there are two types of them: shelled and naked. As you examine the prepared slides you should be able to see water expulsion vesicle, nucleus,

Minerals and Trace Elements Oxygen, carbon, hydrogen and nitrogen are the most common elements that make up 96% of the total weight of a mammal. The next most abundant element

Q. Why do cells of the nephron tubules present a great amount of mitochondria? The cells of the tubule wall have high number of mitochondria because many substances are secrete

When the standard free energy of a reaction is -5.7 kj/mol then at equilibrium a- there will be 10 times more products than reactants b-there will be 10000 times more product

what are characteristics of flagellata class ?

What are the Sources of Vitamin K? As mentioned above, in plants, the only important molecular 'form of vitamin K is phylloquinone. Phylloquinone is distributed ubiquitously th

phylogenetic consideration

Define Behaviour modification - combat from obesity Problem? It is very important. A heavy parental hand and parent attitude and behaviours towards child's eating, interferes i