Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Are there different proteins made by the same total number of amino acids? Different proteins with the similar total number of amino acids may exist. In such cases the separati

Explain Regulatory enzymes Regulatory enzymes:   Citrate  synthase,  isocitrate  dehydrogenase  and a-ketoglutarate dehydrogenase complex are the key  enzymes which  regulate

Cleavage of fructose-1,6-bisphosphate Aldolase cleaves  fructose-1, 6-bisphosphate to dihydroxyacetone phosphate and glyceraldehyde-3-phosphate in the reversible reaction.

Q. What are the main human diseases caused by prions? The major known human diseases of such type are the Creutzfeldt-Jacob disease (CJD), the kuru and the Gerstmann-Sträussle-

Amylopectin Amylopectin forms a branched structure with about 30 glucose units in a chain among branches. There are usually slightly more  'outer' unbranched chains (called A-c

What is the leaf cuticle? The leaf cuticle is a thin waxy layer made of cutin and waxes on the outer surface of the leaf epidermis. Its function is to control the cellular tran

The typological species concept was suggested by Plato more than 2000 years ago. According to this concept, the immense variety in nature can be reduced to a few "types". Individua

Patient Positioning The patient  should be  in  the  left lateral position as  this brings the heart into contact with chest wall. The left arm is extended behind  the head  t

Protein Classification Based on Shape There are three types of proteins on the basis of shape - Fibrous, Globular, Intermediate 1 .       FIBROUS PROTEINS They ar

Define Termination phase - mechanism of protein synthesis? Termination: RNA polymerase recognizes the terminator, which results in no further nucleotides being incorporated and