Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Cells regulate their level of activity by regulating the amount of proteins present in the cell at any given time, so an up regulation of enzymes would be expected to A. increase t

Leaves give off water vapour Use two same pots of soil, one with a small plant and the other without. Cover the soil in every pot with cardboard as shown in the diagram after w

Define Development - Terminologies used in Chromatography? Development is the process of passing a mobile phase over the adsorbent or support. During the development the sample

PURPOSES OF DRESSING A dressing can have a number of purposes, depending on the type, severity and position of the wound, although all purposes are focused towards promoting re

Molybdenum (Mo) Mo is absorbed as molybdate (MOO 2- 4 ) ion by plants. Its uptake can be competitively reduced by SO 2- 4 . The requirement of plants for Mo is very low. Mo

Q. Vitamins and minerals requirement in diabetes? The recommendation of vitamins and minerals is the same as for general population. However, lower levels of magnesium are ass

what is hydrostatic skeleton?

What functions of the smooth ER and rough ER are similar?

SCIENTIFI C METHOD - The scientific approach to explain a particular phenomenon require a series of organized steps based on common sense. It is called scientific method. A

Bergmann's Method of Cell Plating In this method free cells are suspended in a liquid medium at a density twice the finally desired plating density. Melted agar containing med