Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Q. Nutritional management for constipation? Calories, proteins, carbohydrates and fat the requirements would be the same as the RDA for a particular age, sex, occupation of t

What is the Axes of Fick The Axes of Fick show that any eye position can be specified as the amount of rotation around a set of axes fixed in the orbit: 1) Vertical Axis: Z-

Winter Stratification - Thermal stratification During extremes of winter the surface layer of the lake freezes or attains a temperature close to 0° Celsius. Under these condit

What is a biome? A biome is a prevailing ecosystem constituted by same biotic and abiotic factors present in one or more regions of the planet.

What is Neuroscience? Theoretical, mathematical, and computational approaches to queries in neuroscience are now recognized as valid by experimental physiologists. The main neu

What is karyotype? Name the karyotype is given to the set of chromosomes of an individual, generally when visualized and identified under the microscope. The visualization in g

explain why expired air contain co2

On a separate piece of paper, draw a simple family tree for a couple showing children (F1), and lineages from two children showing grand children (G2), great grandchildren (G3), gr

Explain Nutrient needs and Recommended Dietary Allowances? For infants and preschoolers, satisfactory growth is a sensitive criterion of whether needs are met. 50 th percentil

different types of animals and their respiratory organ