Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
modes of nutrition in animals?

Q. What is folic acid? Why is the anemia caused by deficiency of folic acid known as megaloblastic anemia? The folic acid when ionized it is called folate is a coenzyme that pa

Q. Find out risk factors for coronary disease? 1) Tobacco Smoking, the single most preventable cause of death is a leading risk factor for CAD, cerebrovascular accident and

Q. How many ATP molecules are made after glycolysis? Glycolysis is a process similar to glucose degradation in fermentation it produces final balances two molecules of ATP for


Approach grafting In this method both scion and stock remain rooted. A small slice is cut off from the stem of scion and stock. Scion is bent towards the stock. The two c

Amylose Amylose molecules have molecular weights ranging from 10 4 -20 6 . Amylose can form an extended shape (hydrodynamic radius 7-22 nm) but generally tends to wind up into

Antibodies of dissimilar specificities, which react to the same antigen, are known as polyclonal antibodies.

Determine Guidelines to Lower Risk and Wise Use of Drugs? There can be no two views regarding the act that the management of many diseases require drug therapy. However, they m

Tentative treatment planning Once the initial data has been analyed and comprehensive diagnosis and charting of the condition of the mouth has been done, you should formulate a