Effect of single base pair mutation on the cftr protein, Biology

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).

Posted Date: 3/25/2013 5:06:24 AM | Location : United States







Related Discussions:- Effect of single base pair mutation on the cftr protein, Assignment Help, Ask Question on Effect of single base pair mutation on the cftr protein, Get Answer, Expert's Help, Effect of single base pair mutation on the cftr protein Discussions

Write discussion on Effect of single base pair mutation on the cftr protein
Your posts are moderated
Related Questions
Clinical Manifestation   Early onset of dyspnea on exertion (DOE) which progresses to continuous dyspnea. Rhonchi, crackles , accessory muscle breathing, Increased rate of br

Question 1: Show applications of Bioinformatics in pharmacogenomics. Expand FASTA and BLAST. List out any 10 applications of Bioinformatics in pharmacogenomics Expand

Structure of the Vascular Cambium This meristem, in the anatomical sense of the term usually includes two histologically distinct kinds of cells: i) Fusiform Initials, i

Collagen Helix Collagen has a large amount of glycine (25%) and proline (and hydroxyproline, 25%). They run parallel, form a right handed super-helix that is stabilized b

Asexual Reproduction Asexual reproduction is also known agamic reproduction because there is no involvement of gametes in it. Asexual methods of reproduction are

Give detail explanation about Swimming Swimming is an excellent form of exercise. Swimming can improve the posture and circulation. It is a healthy activity. There are certain

During a routine annual physical,a patient was checked to determine the amount of glucose in the blood.After the assay,It was found that the glucose that the glucose concentration

Indicating the name and respective ploidy of each involved cell how can the formation of egg cells from germ cells be described? The formation of egg cells starts with a germ c

Hom o sapiens fossilis (CRO-MAGNO N MAN) - Fossils found from Cro-Magnon, France by Mac Gregor (1868) Replaced Neanderthal man about 35.000 years ago Sharp nose

Normal 0 false false false EN-IN X-NONE X-NONE MicrosoftInternetExplorer4